Lineage for d5qm2b_ (5qm2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486299Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2486300Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2486310Species Escherichia coli [TaxId:562] [100955] (185 PDB entries)
  8. 2486453Domain d5qm2b_: 5qm2 B: [380013]
    automated match to d1fvka_

Details for d5qm2b_

PDB Entry: 5qm2 (more details), 1.92 Å

PDB Description: group deposition of library data - crystal structure of ecdsba after initial refinement with no ligand modelled (structure d9_1)
PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d5qm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qm2b_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d5qm2b_:

Click to download the PDB-style file with coordinates for d5qm2b_.
(The format of our PDB-style files is described here.)

Timeline for d5qm2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5qm2a_