Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (3 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (6 proteins) |
Protein Cystatin [54410] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [54411] (3 PDB entries) |
Domain d1a67__: 1a67 - [38000] |
PDB Entry: 1a67 (more details)
SCOP Domain Sequences for d1a67__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a67__ d.17.1.2 (-) Cystatin {Chicken (Gallus gallus)} gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq
Timeline for d1a67__: