Lineage for d1a67__ (1a67 -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500606Superfamily d.17.1: Cystatin/monellin [54403] (3 families) (S)
    has a additional strand at the N-terminus
  5. 500629Family d.17.1.2: Cystatins [54407] (6 proteins)
  6. 500630Protein Cystatin [54410] (1 species)
  7. 500631Species Chicken (Gallus gallus) [TaxId:9031] [54411] (3 PDB entries)
  8. 500633Domain d1a67__: 1a67 - [38000]

Details for d1a67__

PDB Entry: 1a67 (more details)

PDB Description: chicken egg white cystatin wildtype, nmr, 16 structures

SCOP Domain Sequences for d1a67__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a67__ d.17.1.2 (-) Cystatin {Chicken (Gallus gallus)}
gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

SCOP Domain Coordinates for d1a67__:

Click to download the PDB-style file with coordinates for d1a67__.
(The format of our PDB-style files is described here.)

Timeline for d1a67__: