SCOPe 2.08: Domain d1a67a_: 1a67 A:

Lineage for d1a67a_ (1a67 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin [54410] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [54411] (3 PDB entries)

8. Domain d1a67a_: 1a67 A: [38000]

Details for d1a67a_

PDB Entry: 1a67

PDB Description: chicken egg white cystatin wildtype, nmr, 16 structures

PDB Compounds: (A:) cystatin

SCOPe Domain Sequences for d1a67a_:

Sequence; same for both SEQRES and ATOM records:

>d1a67a_ d.17.1.2 (A:) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]}
gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

Timeline for d1a67a_:

• d1a67a_ first appeared (with stable ids) in SCOP 1.55, called d1a67__
  
• d1a67a_ appears in SCOPe 2.07