Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein Cystatin [54410] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [54411] (3 PDB entries) |
Domain d1a67a_: 1a67 A: [38000] |
PDB Entry: 1a67 (more details)
SCOPe Domain Sequences for d1a67a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a67a_ d.17.1.2 (A:) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]} gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq
Timeline for d1a67a_: