Lineage for d3mon.6 (3mon D:,C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935699Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2935700Protein Monellin, B & A chains together [54405] (1 species)
  7. 2935701Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)
  8. 2935715Domain d3mon.6: 3mon D:,C: [37993]

Details for d3mon.6

PDB Entry: 3mon (more details), 2.8 Å

PDB Description: crystal structures of two intensely sweet proteins
PDB Compounds: (C:) monellin, (D:) monellin

SCOPe Domain Sequences for d3mon.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g3mon.6 d.17.1.1 (D:,C:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d3mon.6:

Click to download the PDB-style file with coordinates for d3mon.6.
(The format of our PDB-style files is described here.)

Timeline for d3mon.6: