PDB entry 3mon

View 3mon on RCSB PDB site
Description: crystal structures of two intensely sweet proteins
Class: sweet-tasting protein
Keywords: sweet-tasting protein
Deposited on 1992-08-26, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.5
  • Chain 'B':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.5
  • Chain 'C':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.6
  • Chain 'D':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.6
  • Chain 'E':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.7
  • Chain 'F':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.7
  • Chain 'G':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.8
  • Chain 'H':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mon.8

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monA (A:)
    reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monB (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monC (C:)
    reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monD (D:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monE (E:)
    reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monF (F:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monG (G:)
    reikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3monH (H:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyene