SCOPe 2.07: Domain d3mon.5: 3mon B:,A:

Lineage for d3mon.5 (3mon B:,A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (2 proteins)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)

8. Domain d3mon.5: 3mon B:,A: [37992]

Details for d3mon.5

PDB Entry: 3mon, 2.8 Å

PDB Description: crystal structures of two intensely sweet proteins

PDB Compounds: (A:) monellin, (B:) monellin

SCOPe Domain Sequences for d3mon.5:

Sequence; same for both SEQRES and ATOM records:

>g3mon.5 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d3mon.5:

• d3mon.5 first appeared (with stable ids) in SCOP 1.55
  
• d3mon.5 appears in SCOPe 2.06
  
• d3mon.5 appears in the current release, SCOPe 2.08