SCOPe 2.07: Domain d6qgpa_: 6qgp A:

Lineage for d6qgpa_ (6qgp A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d6qgpa_: 6qgp A: [379851]
   automated match to d4i15a_
   complexed with fmt, gai, gol, j2e, mg, peg, zn

Details for d6qgpa_

PDB Entry: 6qgp, 1.94 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-0769

PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6qgpa_:

Sequence; same for both SEQRES and ATOM records:

>d6qgpa_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervletr

Timeline for d6qgpa_:

• d6qgpa_ is new in SCOPe 2.07-stable
  
• d6qgpa_ appears in the current release, SCOPe 2.08