Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries) |
Domain d6qgpa_: 6qgp A: [379851] automated match to d4i15a_ complexed with fmt, gai, gol, j2e, mg, peg, zn |
PDB Entry: 6qgp (more details), 1.94 Å
SCOPe Domain Sequences for d6qgpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qgpa_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf fqkivdaclqgmqwtvdriksnraqwervletr
Timeline for d6qgpa_: