SCOPe 2.07: Domain d1f8sd2: 1f8s D:320-432

Lineage for d1f8sd2 (1f8s D:320-432)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein L-aminoacid oxidase [54397] (2 species)

7. Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (3 PDB entries)

8. Domain d1f8sd2: 1f8s D:320-432 [37981]
   Other proteins in same PDB: d1f8sa1, d1f8sb1, d1f8sc1, d1f8sd1, d1f8se1, d1f8sf1, d1f8sg1, d1f8sh1
   complexed with be2, fad, nag

Details for d1f8sd2

PDB Entry: 1f8s, 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

PDB Compounds: (D:) l-amino acid oxidase

SCOPe Domain Sequences for d1f8sd2:

Sequence; same for both SEQRES and ATOM records:

>d1f8sd2 d.16.1.5 (D:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt

Timeline for d1f8sd2:

• d1f8sd2 first appeared (with stable ids) in SCOP 1.55
  
• d1f8sd2 appears in SCOPe 2.06
  
• d1f8sd2 appears in the current release, SCOPe 2.08