Lineage for d1f8sb2 (1f8s B:320-432)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189842Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 189843Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 189959Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (3 proteins)
  6. 189960Protein L-amino acid oxidase [54397] (1 species)
  7. 189961Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (2 PDB entries)
  8. 189967Domain d1f8sb2: 1f8s B:320-432 [37979]
    Other proteins in same PDB: d1f8sa1, d1f8sb1, d1f8sc1, d1f8sd1, d1f8se1, d1f8sf1, d1f8sg1, d1f8sh1

Details for d1f8sb2

PDB Entry: 1f8s (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

SCOP Domain Sequences for d1f8sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8sb2 d.16.1.5 (B:320-432) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt

SCOP Domain Coordinates for d1f8sb2:

Click to download the PDB-style file with coordinates for d1f8sb2.
(The format of our PDB-style files is described here.)

Timeline for d1f8sb2: