Lineage for d6ebga_ (6ebg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007925Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 3007926Protein automated matches [190512] (7 species)
    not a true protein
  7. 3007936Species Chromobacterium violaceum [TaxId:536] [379744] (4 PDB entries)
  8. 3007945Domain d6ebga_: 6ebg A: [379773]
    automated match to d3i07a_
    complexed with j3s; mutant

Details for d6ebga_

PDB Entry: 6ebg (more details), 2.15 Å

PDB Description: ohr (organic hydroperoxide resistance protein) mutant - c60s interacting with dihydrolipoamide
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6ebga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebga_ d.227.1.0 (A:) automated matches {Chromobacterium violaceum [TaxId: 536]}
sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaasf
lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
ivcpysdatrgnidvrlrla

SCOPe Domain Coordinates for d6ebga_:

Click to download the PDB-style file with coordinates for d6ebga_.
(The format of our PDB-style files is described here.)

Timeline for d6ebga_: