PDB entry 6ebg

View 6ebg on RCSB PDB site
Description: Ohr (Organic Hydroperoxide Resistance protein) mutant - C60S interacting with dihydrolipoamide
Class: oxidoreductase
Keywords: Ohr, thiol-proxidase, OXIDOREDUCTASE, dihydrolipoamide
Deposited on 2018-08-06, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (Start-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebga_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (20-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebgb_
  • Chain 'C':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (Start-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebgc_
  • Chain 'D':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (20-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebgd_
  • Heterogens: J3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebgA (A:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaasflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebgA (A:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaasf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ebgB (B:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaasflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebgB (B:)
    msietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaas
    flgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqa
    hivcpysdatrgnidvrlrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ebgC (C:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaasflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebgC (C:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaasf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ebgD (D:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaasflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebgD (D:)
    msietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaas
    flgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqa
    hivcpysdatrgnidvrlrla