SCOPe 2.04: Domain d1h81a2: 1h81 A:294-405

Lineage for d1h81a2 (1h81 A:294-405)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Polyamine oxidase [54395] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [54396] (7 PDB entries)

8. Domain d1h81a2: 1h81 A:294-405 [37971]
   Other proteins in same PDB: d1h81a1, d1h81b1, d1h81c1
   complexed with fad, nag

Details for d1h81a2

PDB Entry: 1h81, 2.1 Å

PDB Description: structure of polyamine oxidase in the reduced state

PDB Compounds: (A:) polyamine oxidase

SCOPe Domain Sequences for d1h81a2:

Sequence; same for both SEQRES and ATOM records:

>d1h81a2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
dmavytkiflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdee
srrieqqsdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsn

Timeline for d1h81a2:

• d1h81a2 first appeared (with stable ids) in SCOP 1.55
  
• d1h81a2 appears in SCOPe 2.03
  
• d1h81a2 appears in SCOPe 2.05
  
• d1h81a2 appears in the current release, SCOPe 2.08