Lineage for d6r2od_ (6r2o D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300568Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. 2300586Domain d6r2od_: 6r2o D: [379629]
    Other proteins in same PDB: d6r2oa_, d6r2oc_
    automated match to d1s0hb1
    complexed with cl, hem, na, peg

Details for d6r2od_

PDB Entry: 6r2o (more details), 2.46 Å

PDB Description: hemoglobin structure from serial crystallography with a 3d-printed nozzle.
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d6r2od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r2od_ a.1.1.2 (D:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahky

SCOPe Domain Coordinates for d6r2od_:

Click to download the PDB-style file with coordinates for d6r2od_.
(The format of our PDB-style files is described here.)

Timeline for d6r2od_: