Lineage for d6kh4a_ (6kh4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704514Species Penaeus japonicus [TaxId:27405] [379454] (15 PDB entries)
  8. 2704544Domain d6kh4a_: 6kh4 A: [379530]
    automated match to d5wpna_
    complexed with fe, ni

Details for d6kh4a_

PDB Entry: 6kh4 (more details), 2.3 Å

PDB Description: design and crystal structure of protein mofs with ferritin nanocages as linkers and nickel clusters as nodes
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6kh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kh4a_ a.25.1.0 (A:) automated matches {Penaeus japonicus [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmqewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragphhglgeymfdkeln

SCOPe Domain Coordinates for d6kh4a_:

Click to download the PDB-style file with coordinates for d6kh4a_.
(The format of our PDB-style files is described here.)

Timeline for d6kh4a_: