SCOPe 2.08: Domain d6jasa1: 6jas A:3-332

Lineage for d6jasa1 (6jas A:3-332)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d6jasa1: 6jas A:3-332 [379439]
   automated match to d4h0wa1
   complexed with cit, fe, mli

Details for d6jasa1

PDB Entry: 6jas, 2.5 Å

PDB Description: human serum transferrin with iron citrate bound

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d6jasa1:

Sequence; same for both SEQRES and ATOM records:

>d6jasa1 c.94.1.0 (A:3-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtcp

Timeline for d6jasa1:

• d6jasa1 first appeared in SCOPe 2.07