Lineage for d6jasa2 (6jas A:339-679)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915586Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)
  8. 2915624Domain d6jasa2: 6jas A:339-679 [379440]
    automated match to d4h0wa2
    complexed with cit, fe, mli

Details for d6jasa2

PDB Entry: 6jas (more details), 2.5 Å

PDB Description: human serum transferrin with iron citrate bound
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d6jasa2:

Sequence, based on SEQRES records: (download)

>d6jasa2 c.94.1.0 (A:339-679) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyi
agkcglvpvlaenynksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrta
gwnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygyt
gafrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanch
larapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvcl
aklhdrntyekylgeeyvkavgnlrkcstsslleactfrrp

Sequence, based on observed residues (ATOM records): (download)

>d6jasa2 c.94.1.0 (A:339-679) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyi
agkcglvpvlaenynagyfavavvkksasdltwdnlkgkkschtavgrtagwnipmglly
nkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygytgafrclvekg
dvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanchlarapnhavv
trkdkeacvhkilrqqqhlfgsngnfclfrsetkdllfrddtvclaklhdrntyekylge
eyvkavgnlrkcstsslleactfrrp

SCOPe Domain Coordinates for d6jasa2:

Click to download the PDB-style file with coordinates for d6jasa2.
(The format of our PDB-style files is described here.)

Timeline for d6jasa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jasa1