![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
![]() | Protein Sarcosine oxidase [54388] (1 species) |
![]() | Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries) |
![]() | Domain d1elia2: 1eli A:218-321 [37943] Other proteins in same PDB: d1elia1, d1elib1 complexed with cl, fad, po4, pyc |
PDB Entry: 1eli (more details), 2 Å
SCOPe Domain Sequences for d1elia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elia2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d1elia2: