PDB entry 1eli

View 1eli on RCSB PDB site
Description: complex of monomeric sarcosine oxidase with the inhibitor pyrrole-2-carboxylate
Class: oxidoreductase
Keywords: flavoprotein, oxidase, OXIDOREDUCTASE
Deposited on 2000-03-13, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sarcosine oxidase
    Species: Bacillus sp. [TaxId:69000]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40859 (0-End)
      • modified residue (13)
      • modified residue (15)
      • modified residue (104)
      • modified residue (200)
      • modified residue (244)
      • modified residue (301)
      • modified residue (315)
    Domains in SCOPe 2.07: d1elia1, d1elia2
  • Chain 'B':
    Compound: sarcosine oxidase
    Species: Bacillus sp. [TaxId:69000]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40859 (0-End)
      • modified residue (13)
      • modified residue (15)
      • modified residue (104)
      • modified residue (200)
      • modified residue (244)
      • modified residue (301)
      • modified residue (315)
    Domains in SCOPe 2.07: d1elib1, d1elib2
  • Heterogens: PO4, CL, FAD, PYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eliA (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eliA (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eliB (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eliB (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq