Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) |
Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins) |
Protein Sarcosine oxidase [54388] (1 species) |
Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (6 PDB entries) |
Domain d1el8b2: 1el8 B:218-321 [37942] Other proteins in same PDB: d1el8a1, d1el8b1 |
PDB Entry: 1el8 (more details), 1.9 Å
SCOP Domain Sequences for d1el8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el8b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618} lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d1el8b2: