SCOPe 2.07: Domain d6pqia1: 6pqi A:25-265

Lineage for d6pqia1 (6pqi A:25-265)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6pqia1: 6pqi A:25-265 [379279]
   Other proteins in same PDB: d6pqia2, d6pqib2, d6pqic2, d6pqid2
   automated match to d5tg5a_
   complexed with act, cef, cl

Details for d6pqia1

PDB Entry: 6pqi, 2.05 Å

PDB Description: crystal structure of class d beta-lactamase oxa-48 with cefotaxime

PDB Compounds: (A:) Class D Carbapenemase OXA-48

SCOPe Domain Sequences for d6pqia1:

Sequence; same for both SEQRES and ATOM records:

>d6pqia1 e.3.1.0 (A:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d6pqia1:

• d6pqia1 is new in SCOPe 2.07-stable
  
• d6pqia1 appears in the current release, SCOPe 2.08