Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries) |
Domain d6pqia1: 6pqi A:25-265 [379279] Other proteins in same PDB: d6pqia2, d6pqib2, d6pqic2, d6pqid2 automated match to d5tg5a_ complexed with act, cef, cl |
PDB Entry: 6pqi (more details), 2.05 Å
SCOPe Domain Sequences for d6pqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pqia1 e.3.1.0 (A:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]} wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii p
Timeline for d6pqia1: