Lineage for d1pbf_2 (1pbf 174-275)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131415Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 131416Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 131428Family d.16.1.2: PHBH-like [54378] (2 proteins)
  6. 131429Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)
  7. 131448Species Pseudomonas fluorescens [TaxId:294] [54380] (17 PDB entries)
  8. 131460Domain d1pbf_2: 1pbf 174-275 [37880]
    Other proteins in same PDB: d1pbf_1

Details for d1pbf_2

PDB Entry: 1pbf (more details), 2.7 Å

PDB Description: crystal structures of wild-type p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate, 2,4-dihydroxybenzoate and 2-hydroxy- 4-aminobenzoate and of the try222ala mutant, complexed with 2- hydroxy-4-aminobenzoate. evidence for a proton channel and a new binding mode of the flavin ring

SCOP Domain Sequences for d1pbf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbf_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryavqvpltekved
wsderfwtelkarlpaevaeklvtgpsleksiaplrsfvvep

SCOP Domain Coordinates for d1pbf_2:

Click to download the PDB-style file with coordinates for d1pbf_2.
(The format of our PDB-style files is described here.)

Timeline for d1pbf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pbf_1