SCOP 1.71: Domain d1cboa2: 1cbo A:319-450

Lineage for d1cboa2 (1cbo A:319-450)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (2 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (10 PDB entries)

8. Domain d1cboa2: 1cbo A:319-450 [37867]
   Other proteins in same PDB: d1cboa1
   complexed with fad; mutant

Details for d1cboa2

PDB Entry: 1cbo, 1.8 Å

PDB Description: cholesterol oxidase from streptomyces his447asn mutant

SCOP Domain Sequences for d1cboa2:

Sequence; same for both SEQRES and ATOM records:

>d1cboa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcynplg

Timeline for d1cboa2:

• d1cboa2 first appeared (with stable ids) in SCOP 1.55
  
• d1cboa2 appears in SCOP 1.69
  
• d1cboa2 appears in SCOP 1.73
  
• d1cboa2 appears in the current release, SCOPe 2.08