Lineage for d1cboa2 (1cbo A:319-450)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) 
Family d.16.1.1: Cholesterol oxidase [54374] (1 protein) Protein Cholesterol oxidase [54375] (2 species) Species Streptomyces sp. [TaxId:1931] [54377] (4 PDB entries) 
Domain d1cboa2: 1cbo A:319-450 [37867]
Other proteins in same PDB: d1cboa1
Details for d1cboa2
PDB Entry: 1cbo (more details), 1.8 Å
PDB Description: cholesterol oxidase from streptomyces his447asn mutant
SCOP Domain Sequences for d1cboa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cboa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcynplg
SCOP Domain Coordinates for d1cboa2:
Click to download the PDB-style file with coordinates for d1cboa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cboa2:
- d1cboa2 appears in SCOP 1.57
- d1cboa2 appears in the current release, SCOPe 2.08
View in 3D
