Lineage for d6r9wf_ (6r9w F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450398Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2450531Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (94 PDB entries)
  8. 2450597Domain d6r9wf_: 6r9w F: [378660]
    automated match to d4tzka_
    complexed with jvz, nad

Details for d6r9wf_

PDB Entry: 6r9w (more details), 1.75 Å

PDB Description: crystal structure of inha in complex with ap-124 inhibitor
PDB Compounds: (F:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d6r9wf_:

Sequence, based on SEQRES records: (download)

>d6r9wf_ c.2.1.2 (F:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records): (download)

>d6r9wf_ c.2.1.2 (F:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitsiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplleld
vqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisa
ysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygv
rsnlvaagpiegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d6r9wf_:

Click to download the PDB-style file with coordinates for d6r9wf_.
(The format of our PDB-style files is described here.)

Timeline for d6r9wf_: