SCOPe 2.08: Domain d6pgoa_: 6pgo A:

Lineage for d6pgoa_ (6pgo A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d6pgoa_: 6pgo A: [378621]
   automated match to d2iezb_
   complexed with gdp, mg, oj1

Details for d6pgoa_

PDB Entry: 6pgo, 1.6 Å

PDB Description: crystal structure of human kras g12c covalently bound to a phthalazine inhibitor

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6pgoa_:

Sequence, based on SEQRES records:

>d6pgoa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6pgoa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
rdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdt
kqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6pgoa_:

• d6pgoa_ first appeared in SCOPe 2.07