![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187321] (11 PDB entries) |
![]() | Domain d6maja1: 6maj A:336-607 [378565] Other proteins in same PDB: d6maja2 automated match to d5gk9a_ complexed with gol, jav, zn |
PDB Entry: 6maj (more details), 2.14 Å
SCOPe Domain Sequences for d6maja1:
Sequence, based on SEQRES records: (download)
>d6maja1 d.108.1.1 (A:336-607) automated matches {Human (Homo sapiens) [TaxId: 9606]} miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl krqdlidewiakeakrsnsnktmdpsclkwtp
>d6maja1 d.108.1.1 (A:336-607) automated matches {Human (Homo sapiens) [TaxId: 9606]} miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl krqdlidewiakenktmdpsclkwtp
Timeline for d6maja1: