SCOP 1.57: Domain d2ptl__: 2ptl -

Lineage for d2ptl__ (2ptl -)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (4 PDB entries)

8. Domain d2ptl__: 2ptl - [37835]

Details for d2ptl__

PDB Entry: 2ptl

PDB Description: three-dimensional solution structure of an immunoglobulin light chain- binding domain of protein l. comparison with the igg-binding domains of protein g

SCOP Domain Sequences for d2ptl__:

Sequence; same for both SEQRES and ATOM records:

>d2ptl__ d.15.7.1 (-) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge
ytvdvadkgytlnikfag

Timeline for d2ptl__:

• d2ptl__ first appeared (with stable ids) in SCOP 1.55
  
• d2ptl__ appears in SCOP 1.59
  
• d2ptl__ appears in the current release, SCOPe 2.08, called d2ptla_