PDB entry 2ptl

View 2ptl on RCSB PDB site
Description: three-dimensional solution structure of an immunoglobulin light chain- binding domain of protein l. comparison with the igg-binding domains of protein g
Deposited on 1994-08-12, released 1994-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2ptl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ptl_ (-)
    enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge
    ytvdvadkgytlnikfag