Lineage for d1fnwh2 (1fnw H:2208-2321)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131246Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 131247Species Streptococcus pyogenes [TaxId:1314] [54357] (4 PDB entries)
  8. 131267Domain d1fnwh2: 1fnw H:2208-2321 [37820]
    Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1

Details for d1fnwh2

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwh2 d.15.6.1 (H:2208-2321) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnwh2:

Click to download the PDB-style file with coordinates for d1fnwh2.
(The format of our PDB-style files is described here.)

Timeline for d1fnwh2: