Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries) |
Domain d1fnwg2: 1fnw G:1908-2021 [37819] Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1 |
PDB Entry: 1fnw (more details), 3.9 Å
SCOP Domain Sequences for d1fnwg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnwg2 d.15.6.1 (G:1908-2021) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk
Timeline for d1fnwg2: