Lineage for d1fnwe1 (1fnw E:1201-1307)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 374369Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 374426Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 374427Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 374452Domain d1fnwe1: 1fnw E:1201-1307 [25228]
    Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2

Details for d1fnwe1

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwe1 b.40.2.2 (E:1201-1307) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnwe1:

Click to download the PDB-style file with coordinates for d1fnwe1.
(The format of our PDB-style files is described here.)

Timeline for d1fnwe1: