SCOPe 2.07: Domain d6ocub_: 6ocu B:

Lineage for d6ocub_ (6ocu B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family)
   Pfam PF16454

5. Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)

6. Protein automated matches [310859] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [311310] (9 PDB entries)

8. Domain d6ocub_: 6ocu B: [378122]
   automated match to d5vlrb_
   complexed with m5d

Details for d6ocub_

PDB Entry: 6ocu, 2.77 Å

PDB Description: human pi3kdelta in complex with compound 29

PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6ocub_:

Sequence, based on SEQRES records:

>d6ocub_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafneti
kifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkk
qaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

Sequence, based on observed residues (ATOM records):

>d6ocub_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qqdqdnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikife
eqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaae
yreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

Timeline for d6ocub_:

• d6ocub_ is new in SCOPe 2.07-stable
  
• d6ocub_ appears in the current release, SCOPe 2.08