Lineage for d1fnvc2 (1fnv C:708-821)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599052Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 599053Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 599119Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 599120Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
  8. 599143Domain d1fnvc2: 1fnv C:708-821 [37811]
    Other proteins in same PDB: d1fnva1, d1fnvb1, d1fnvc1, d1fnvd1

Details for d1fnvc2

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvc2 d.15.6.1 (C:708-821) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnvc2:

Click to download the PDB-style file with coordinates for d1fnvc2.
(The format of our PDB-style files is described here.)

Timeline for d1fnvc2: