SCOP 1.71: Domain d1fnvb1: 1fnv B:301-407

Lineage for d1fnvb1 (1fnv B:301-407)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Domain d1fnvb1: 1fnv B:301-407 [25221]
Other proteins in same PDB: d1fnva2, d1fnvb2, d1fnvc2, d1fnvd2

Details for d1fnvb1

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvb1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnvb1:

Click to download the PDB-style file with coordinates for d1fnvb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnvb1: