Lineage for d6naja4 (6naj A:738-954)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374900Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2374929Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2374930Protein automated matches [233857] (1 species)
    not a true protein
  7. 2374931Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)
  8. 2374958Domain d6naja4: 6naj A:738-954 [378030]
    Other proteins in same PDB: d6naja1, d6najc_
    automated match to d1m1xa3
    complexed with bma, man, mn, nag

Details for d6naja4

PDB Entry: 6naj (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to hr10 variant of the 10th domain of fibronectin.
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d6naja4:

Sequence, based on SEQRES records: (download)

>d6naja4 b.1.15.0 (A:738-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwg

Sequence, based on observed residues (ATOM records): (download)

>d6naja4 b.1.15.0 (A:738-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikihtlgcgvaqclkivcqvgrldr
gksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnv
twg

SCOPe Domain Coordinates for d6naja4:

Click to download the PDB-style file with coordinates for d6naja4.
(The format of our PDB-style files is described here.)

Timeline for d6naja4: