Lineage for d6k0yb2 (6k0y B:107-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2361481Domain d6k0yb2: 6k0y B:107-213 [377997]
    Other proteins in same PDB: d6k0yb1, d6k0yc_
    automated match to d1dn0a2
    complexed with edo

Details for d6k0yb2

PDB Entry: 6k0y (more details), 1.7 Å

PDB Description: study of the interactions of a novel monoclonal antibody, mab059c, with the hpd-1 receptor
PDB Compounds: (B:) Antibody Light Chain

SCOPe Domain Sequences for d6k0yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k0yb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6k0yb2:

Click to download the PDB-style file with coordinates for d6k0yb2.
(The format of our PDB-style files is described here.)

Timeline for d6k0yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6k0yb1
View in 3D
Domains from other chains:
(mouse over for more information)
d6k0yc_