Lineage for d1eu3a2 (1eu3 A:97-209)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131268Protein Streptococcal superantigen Smez-2 [54352] (1 species)
  7. 131269Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)
  8. 131270Domain d1eu3a2: 1eu3 A:97-209 [37795]
    Other proteins in same PDB: d1eu3a1, d1eu3b1

Details for d1eu3a2

PDB Entry: 1eu3 (more details), 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu3a2 d.15.6.1 (A:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

SCOP Domain Coordinates for d1eu3a2:

Click to download the PDB-style file with coordinates for d1eu3a2.
(The format of our PDB-style files is described here.)

Timeline for d1eu3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu3a1