SCOPe 2.08: Domain d6u8la_: 6u8l A:

Lineage for d6u8la_ (6u8l A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)

8. Domain d6u8la_: 6u8l A: [377886]
   automated match to d4gm9b_
   complexed with q1p, q1s

Details for d6u8la_

PDB Entry: 6u8l, 1.57 Å

PDB Description: discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the wdr5:myc protein-protein interaction

PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6u8la_:

Sequence; same for both SEQRES and ATOM records:

>d6u8la_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Timeline for d6u8la_:

• d6u8la_ first appeared in SCOPe 2.07