Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries) |
Domain d6o41o1: 6o41 O:5-61 [377733] Other proteins in same PDB: d6o41a1, d6o41a2, d6o41c1, d6o41c2, d6o41l1, d6o41l2, d6o41m2, d6o41n2, d6o41o2 automated match to d2igga_ complexed with gol |
PDB Entry: 6o41 (more details), 2.47 Å
SCOPe Domain Sequences for d6o41o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o41o1 d.15.7.1 (O:5-61) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} vttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
Timeline for d6o41o1: