SCOPe 2.07: Domain d6o41o1: 6o41 O:5-61

Lineage for d6o41o1 (6o41 O:5-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)

8. Domain d6o41o1: 6o41 O:5-61 [377733]
   Other proteins in same PDB: d6o41a1, d6o41a2, d6o41c1, d6o41c2, d6o41l1, d6o41l2, d6o41m2, d6o41n2, d6o41o2
   automated match to d2igga_
   complexed with gol

Details for d6o41o1

PDB Entry: 6o41, 2.47 Å

PDB Description: crystal structure of the unbound pgzl1 germline fab fragment (pgzl1_gvmdmj)

PDB Compounds: (O:) Immunoglobulin G-binding protein G (DOMAIN III)

SCOPe Domain Sequences for d6o41o1:

Sequence; same for both SEQRES and ATOM records:

>d6o41o1 d.15.7.1 (O:5-61) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
vttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

Timeline for d6o41o1:

• d6o41o1 is new in SCOPe 2.07-stable
  
• d6o41o1 appears in the current release, SCOPe 2.08