SCOP 1.65: Domain d3seb_2: 3seb 122-238

Lineage for d3seb_2 (3seb 122-238)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)

8. Domain d3seb_2: 3seb 122-238 [37773]
   Other proteins in same PDB: d3seb_1

Details for d3seb_2

PDB Entry: 3seb, 1.48 Å

PDB Description: staphylococcal enterotoxin b

SCOP Domain Sequences for d3seb_2:

Sequence; same for both SEQRES and ATOM records:

>d3seb_2 d.15.6.1 (122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d3seb_2:

• d3seb_2 first appeared (with stable ids) in SCOP 1.55
  
• d3seb_2 appears in SCOP 1.63
  
• d3seb_2 appears in SCOP 1.67
  
• d3seb_2 appears in the current release, SCOPe 2.08, called d3seba2