Lineage for d3seb_2 (3seb 122-238)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) Species Staphylococcus aureus [TaxId:1280] [54343] (10 PDB entries) 
Domain d3seb_2: 3seb 122-238 [37773]
Other proteins in same PDB: d3seb_1
Details for d3seb_2
PDB Entry: 3seb (more details), 1.48 Å
PDB Description: staphylococcal enterotoxin b
SCOP Domain Sequences for d3seb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3seb_2 d.15.6.1 (122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
SCOP Domain Coordinates for d3seb_2:
Click to download the PDB-style file with coordinates for d3seb_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3seb_2:
- d3seb_2 appears in SCOP 1.57
- d3seb_2 appears in the current release, SCOPe 2.08, called d3seba2
View in 3D
