SCOPe 2.07: Domain d6ktab2: 6kta B:63-137

Lineage for d6ktab2 (6kta B:63-137)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.0: automated matches [254293] (1 protein)
   not a true family

6. Protein automated matches [254677] (2 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [377693] (2 PDB entries)

8. Domain d6ktab2: 6kta B:63-137 [377694]
   Other proteins in same PDB: d6ktaa1, d6ktab1
   automated match to d2ev0a2
   complexed with gol

Details for d6ktab2

PDB Entry: 6kta, 2.3 Å

PDB Description: crystal structure of b. halodurans mntr in apo form

PDB Compounds: (B:) HTH-type transcriptional regulator MntR

SCOPe Domain Sequences for d6ktab2:

Sequence; same for both SEQRES and ATOM records:

>d6ktab2 a.76.1.0 (B:63-137) automated matches {Bacillus halodurans [TaxId: 272558]}
takgkkigkrlvyrhdlledflkmigvdsdhiyedvegiehhlswdaidrigdlvqyfqe
dpsrlndlrevqkkn

Timeline for d6ktab2:

• d6ktab2 is new in SCOPe 2.07-stable
  
• d6ktab2 appears in the current release, SCOPe 2.08