SCOPe 2.08: Domain d6pw1a_: 6pw1 A:

Lineage for d6pw1a_ (6pw1 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [189626] (6 PDB entries)

8. Domain d6pw1a_: 6pw1 A: [377556]
   Other proteins in same PDB: d6pw1b1, d6pw1b2, d6pw1b3, d6pw1d1, d6pw1d2, d6pw1d3
   automated match to d3omaa_
   complexed with ca, cd, cu, dmu, hea, hth, mg, trd, trs

Details for d6pw1a_

PDB Entry: 6pw1, 2.1 Å

PDB Description: cytochrome c oxidase delta 16

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d6pw1a_:

Sequence; same for both SEQRES and ATOM records:

>d6pw1a_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

Timeline for d6pw1a_:

• d6pw1a_ first appeared in SCOPe 2.07