Lineage for d6q6ma_ (6q6m A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343133Domain d6q6ma_: 6q6m A: [377545]
    automated match to d3l0la_
    complexed with hjw

Details for d6q6ma_

PDB Entry: 6q6m (more details), 2.35 Å

PDB Description: rorcvar2 (rorgt, 264-499) in complex with compound 1: identification of n-aryl imidazoles as potent and selective rorgt inhibitors
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6q6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q6ma_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlh

SCOPe Domain Coordinates for d6q6ma_:

Click to download the PDB-style file with coordinates for d6q6ma_.
(The format of our PDB-style files is described here.)

Timeline for d6q6ma_: