Lineage for d6jhbb_ (6jhb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847631Species Microcystis aeruginosa [TaxId:1235808] [377327] (3 PDB entries)
  8. 2847637Domain d6jhbb_: 6jhb B: [377348]
    automated match to d3oifb_
    complexed with eno, ndp

Details for d6jhbb_

PDB Entry: 6jhb (more details), 2.27 Å

PDB Description: crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa
PDB Compounds: (B:) Short chain dehydrogenase family protein

SCOPe Domain Sequences for d6jhbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jhbb_ c.2.1.0 (B:) automated matches {Microcystis aeruginosa [TaxId: 1235808]}
mdlglkdkvalitgssagigftiaeklaeegchliicgrnsqrleqayqslaqaypaqqi
lrlvadvhqaqdseqliqdslnqygkidilvnnseganfaenlienlsdedwlnvfqgkl
igyirltnlvlpimkkqhwgrivniigtsgkepsprlvksgvvnaalmnftksvarqtap
ynvlinsvnpgvidtprhreyleiyakkegttpdlirerilktipmnrigtteefanlvv
flasecasyitgitipldgglsss

SCOPe Domain Coordinates for d6jhbb_:

Click to download the PDB-style file with coordinates for d6jhbb_.
(The format of our PDB-style files is described here.)

Timeline for d6jhbb_: