Lineage for d1bmlc1 (1bml C:12-148)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131167Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
  5. 131168Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)
  6. 131181Protein Streptokinase [54332] (1 species)
  7. 131182Species Streptococcus equisimilis [TaxId:119602] [54333] (3 PDB entries)
  8. 131191Domain d1bmlc1: 1bml C:12-148 [37729]
    Other proteins in same PDB: d1bmla_, d1bmlb_

Details for d1bmlc1

PDB Entry: 1bml (more details), 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase

SCOP Domain Sequences for d1bmlc1:

Sequence, based on SEQRES records: (download)

>d1bmlc1 d.15.5.1 (C:12-148) Streptokinase {Streptococcus equisimilis}
svnnsqlvvsvagtvegtnqdislkffeidltsrpahggkteqglspkskpfatdsgamp
hklekadllkaiqeqlianvhsnddyfevidfasdatitdrngkvyfadkdgsvtlptqp
vqefllsghvrvrpyke

Sequence, based on observed residues (ATOM records): (download)

>d1bmlc1 d.15.5.1 (C:12-148) Streptokinase {Streptococcus equisimilis}
svnnsqlvvsvagtvegtnqdislkffeidltsrphklekadllkaiqeqlianvhsndd
yfevidfasdatitdrngkvyfadkdgsvtlptqpvqefllsghvrvrpyke

SCOP Domain Coordinates for d1bmlc1:

Click to download the PDB-style file with coordinates for d1bmlc1.
(The format of our PDB-style files is described here.)

Timeline for d1bmlc1: