Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) automatically mapped to Pfam PF02821 |
Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins) |
Protein Staphylokinase [54330] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries) phage-borne; Bacteriophage 42D |
Domain d1c78a_: 1c78 A: [37712] |
PDB Entry: 1c78 (more details), 2.3 Å
SCOPe Domain Sequences for d1c78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c78a_ d.15.5.1 (A:) Staphylokinase {Staphylococcus aureus [TaxId: 1280]} gkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvew aldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfn litkvviekk
Timeline for d1c78a_: