SCOPe 2.07: Domain d6l6qb_: 6l6q B:

Lineage for d6l6qb_ (6l6q B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein automated matches [190314] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188623] (7 PDB entries)

8. Domain d6l6qb_: 6l6q B: [377073]
   automated match to d1a6yb_
   complexed with zn

Details for d6l6qb_

PDB Entry: 6l6q, 2.6 Å

PDB Description: structural basis of nr4a2 homodimers binding to selective nur- responsive elements

PDB Compounds: (B:) Nuclear receptor related 1

SCOPe Domain Sequences for d6l6qb_:

Sequence; same for both SEQRES and ATOM records:

>d6l6qb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lcavcgdnaacqhygvrtcegckgffkrtvqknakyvclankncpvdkrrrnrcqycrfq
kclavgmvkevvrtdslkgrrgrlp

Timeline for d6l6qb_:

• d6l6qb_ is new in SCOPe 2.07-stable
  
• d6l6qb_ appears in the current release, SCOPe 2.08