Lineage for d6i4va_ (6i4v A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618031Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2618032Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2618033Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2618218Protein automated matches [190484] (2 species)
    not a true protein
  7. 2618219Species Human (Homo sapiens) [TaxId:9606] [188559] (24 PDB entries)
  8. 2618229Domain d6i4va_: 6i4v A: [377054]
    automated match to d1hp7a_
    complexed with gly, h3b

Details for d6i4va_

PDB Entry: 6i4v (more details), 1.78 Å

PDB Description: alpha-1-antitrypsin queen's (k154n) variant
PDB Compounds: (A:) alpha-1-antitrypsin

SCOPe Domain Sequences for d6i4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4va_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
tvnfgdteeankqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
eeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqhl
enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
eaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntkspl
fmgkvvnptqk

SCOPe Domain Coordinates for d6i4va_:

Click to download the PDB-style file with coordinates for d6i4va_.
(The format of our PDB-style files is described here.)

Timeline for d6i4va_: