Lineage for d6i1ea1 (6i1e A:50-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004548Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)
  8. 3004549Domain d6i1ea1: 6i1e A:50-221 [377033]
    Other proteins in same PDB: d6i1ea2, d6i1ea3
    automated match to d4weka1
    complexed with axl

Details for d6i1ea1

PDB Entry: 6i1e (more details), 1.64 Å

PDB Description: crystal structure of pseudomonas aeruginosa penicillin-binding protein 3 in complex with amoxicillin
PDB Compounds: (A:) Peptidoglycan D,D-transpeptidase FtsI

SCOPe Domain Sequences for d6i1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i1ea1 d.175.1.0 (A:50-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtkl
fadrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftd
vddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

SCOPe Domain Coordinates for d6i1ea1:

Click to download the PDB-style file with coordinates for d6i1ea1.
(The format of our PDB-style files is described here.)

Timeline for d6i1ea1: